PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Peaxi162Scf00469g00412.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Petunioideae; Petunia
Family G2-like
Protein Properties Length: 79aa    MW: 8922.42 Da    PI: 10.5757
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Peaxi162Scf00469g00412.1genomeSGNView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like52.98.2e-1720512455
                   G2-like 24 sekAtPktilelmkvkgLtlehvkSHLQkYRl 55
                                +AtPk++le m+vkgL+++h+kSHLQ+YR+
  Peaxi162Scf00469g00412.1 20 LGRATPKQVLEQMNVKGLSINHIKSHLQMYRS 51
                              569****************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466891.97E-61852IPR009057Homeodomain-like
TIGRFAMsTIGR015575.2E-132053IPR006447Myb domain, plants
Gene3DG3DSA:1.10.10.601.8E-142152IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 79 aa     Download sequence    Send to blast
MSCLLKEKVS KEKDKNQGDL GRATPKQVLE QMNVKGLSIN HIKSHLQMYR SKKLQDAGSV  60
LSPSSRLING KAHLEMYQK
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010657046.15e-17PREDICTED: uncharacterized protein LOC104880828
TrEMBLF6H5049e-18F6H504_VITVI; Putative uncharacterized protein
STRINGVIT_12s0028g02080.t013e-17(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA2533622
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G42660.12e-14G2-like family protein